Skip to content
Zaffaron

Soup-e Nokhod Farangi (سوپ نخود فرنگی) — Persian Creamy Pea and Veal Soup

A velvety Persian pea soup enriched with tender veal, fine macaroni, and a touch of heavy cream. Fresh chives and black pepper brighten the sweetness of green peas in a comforting, elegant starter.

By Zaffaron Kitchen· Published March 16, 2026 Verified Recipe
Nut-Free Halal
Contains: dairy, gluten
75 min total Prep 20m · Cook 55m 6 servings 420 cal ~$3.2/serving
↓ Jump to Recipe
Soup-e Nokhod Farangi — Persian Creamy Pea and Veal Soup - authentic persian recipe

Printable Recipe Card

Servings: 6 · Total: 75 min · Difficulty: medium

Ingredients (quick list)

  • 350 g Veal stew meat, trimmed and cut into 1.5 cm cubes (From shoulder or leg; keep pieces uniform for even cooking)
  • 30 ml Vegetable oil (Neutral oil such as sunflower or canola)
  • 150 g Onion, finely chopped (About 1 medium)
  • 1200 ml Chicken broth, low-sodium (Homemade or store-bought; keep extra hot water ready if needed)
  • 400 ml Water (Used to adjust thickness while simmering)
  • 500 g Green peas (Fresh or frozen; if fresh, shelled weight)
  • 70 g Fine macaroni (vermicelli-style), broken into 2–3 cm pieces (Thin soup noodles; do not use thick pasta)
  • 180 ml Heavy cream (At least 35% fat; bring to room temperature to reduce curdling risk)
  • 20 g Fresh chives, finely chopped (Plus extra for garnish if desired)
  • 8 g Salt (Adjust to taste depending on broth salinity)
  • 1.5 g Black pepper, freshly ground (About 3/4 teaspoon, plus more to taste)

Steps (summary)

  1. Heat a heavy pot over medium heat for 2 minutes. Add the vegetable oil and chopped onion, then cook 8–10 minutes, stirring ofte…
  2. Pour in the chicken broth and water, scraping the bottom to release any browned bits. Bring to a gentle boil over medium-high h…
  3. Add the green peas, return to a gentle simmer, and cook 10–12 minutes until peas are tender and the veal is easily pierced. If…
  4. Turn off the heat. Blend the soup until very smooth using an immersion blender, 1–2 minutes, or carefully in a countertop blend…
  5. Stir in the broken fine macaroni and simmer 6–8 minutes, stirring every minute to prevent sticking, until just tender. The nood…
  6. Lower the heat to the smallest flame. Stir in salt and black pepper. Slowly pour in the room-temperature heavy cream while stir…

Cultural Background

Creamy soups made with peas and small pasta are commonly served as a warming first course in Iranian home cooking, especially in cooler months. Versions with meat and cream are often prepared for guests because the smooth texture and rich finish feel more formal than everyday brothy soups.

sweetsavorycreamyvelvetysilkytenderfresh herbsgentle pepperslow-simmered broth🌶 mild

Equipment

Heavy pot or Dutch oven (4–6 L)Wooden spoon or heatproof spatulaChef’s knife and cutting boardMeasuring cups and spoonsImmersion blender or countertop blenderLadle

💡 Tips

  • For the smoothest texture, blend thoroughly before adding the macaroni; noodles can make blending gummy.
  • Keep the soup at a gentle simmer after blending; hard boiling can dull the pea flavor and increase the chance of cream splitting.
  • If using frozen peas, add them straight from frozen; they cook quickly and keep a bright, sweet taste.
  • For a more luxurious finish, reserve 2 tablespoons of cream to drizzle on each bowl just before serving.

⚠️ Common Mistakes

  • ❌ Boiling the soup after adding heavy cream

    💡 Why: High heat can cause the cream to split and the soup to look grainy.

    ✅ Fix: Keep the heat very low; warm 2–3 minutes only. If it starts to boil, remove from heat and whisk gently.

  • ❌ Overcooking the fine macaroni

    💡 Why: Thin pasta turns mushy quickly and thickens the soup excessively as it sits.

    ✅ Fix: Cook just until slightly firm, then rest off-heat. Add extra broth or water when reheating.

  • ❌ Blending with pasta already in the pot

    💡 Why: Blended noodles can make the soup gluey and dull the clean pea flavor.

    ✅ Fix: Blend the pea-and-veal base first until smooth, then simmer the pasta afterward.

  • ❌ Using very salty broth and seasoning early

    💡 Why: Reduction during simmering concentrates salt, making the final soup overly salty.

    ✅ Fix: Use low-sodium broth and add most of the salt near the end, tasting after the cream is added.

🧊 How to Store

Cool to room temperature within 2 hours, then refrigerate in an airtight container for up to 3 days. Reheat gently over low heat, stirring often; do not boil. The macaroni absorbs liquid, so add 60–120 ml water or broth when reheating. Freezing is not ideal due to cream separation and softened noodles.

📅 Make Ahead

Cook the veal in broth up to 1 day ahead and refrigerate. Reheat gently, add peas, blend, then cook the macaroni and finish with cream and chives just before serving for the freshest color and best texture.

🍽️ Pairs Well With

  • Warm flatbread or crusty bread
  • A simple herb platter (fresh herbs
  • radishes
  • cucumber)
  • A light salad with lemony dressing

Regional Variations

  • Tehran-style home cookingOften kept very smooth and pale green, with fine macaroni and a modest amount of cream, served as a light starter before rice dishes.
  • Northern Iran-inspiredFrequently finished with more fresh herbs (such as extra chives) and a slightly looser consistency, emphasizing a brighter, garden-forward pea flavor.
family dinner holiday gathering winter meals dinner party starter
#comfort-food#creamy#family-style#starter#winter

Ingredients

  • 350 gVeal stew meat, trimmed and cut into 1.5 cm cubes (From shoulder or leg; keep pieces uniform for even cooking)
  • 30 mlVegetable oil (Neutral oil such as sunflower or canola)
  • 150 gOnion, finely chopped (About 1 medium)
  • 1200 mlChicken broth, low-sodium (Homemade or store-bought; keep extra hot water ready if needed)
  • 400 mlWater (Used to adjust thickness while simmering)
  • 500 gGreen peas (Fresh or frozen; if fresh, shelled weight)
  • 70 gFine macaroni (vermicelli-style), broken into 2–3 cm pieces (Thin soup noodles; do not use thick pasta)
  • 180 mlHeavy cream (At least 35% fat; bring to room temperature to reduce curdling risk)
  • 20 gFresh chives, finely chopped (Plus extra for garnish if desired)
  • 8 gSalt (Adjust to taste depending on broth salinity)
  • 1.5 gBlack pepper, freshly ground (About 3/4 teaspoon, plus more to taste)

🔄 Substitutions

  • Veal stew meat→ Boneless lamb shoulder or beef chuck
  • Heavy cream→ Half-and-half mixed with 1 tablespoon cornstarch (8 g) per 180 ml
  • Fine macaroni→ Orzo or small soup pasta

Instructions

  1. 1

    Heat a heavy pot over medium heat for 2 minutes. Add the vegetable oil and chopped onion, then cook 8–10 minutes, stirring often, until soft and lightly golden. Add the veal cubes and cook 6–8 minutes, turning, until the surface loses its raw color and picks up light browning.

  2. 2

    Pour in the chicken broth and water, scraping the bottom to release any browned bits. Bring to a gentle boil over medium-high heat, then reduce to low, partially cover, and simmer 30 minutes. Skim any foam during the first 10 minutes for a cleaner, more refined soup.

  3. 3

    Add the green peas, return to a gentle simmer, and cook 10–12 minutes until peas are tender and the veal is easily pierced. If the pot looks dry, add 100–200 ml hot water; the peas should be fully submerged for even cooking and a smooth puree.

  4. 4

    Turn off the heat. Blend the soup until very smooth using an immersion blender, 1–2 minutes, or carefully in a countertop blender in batches (do not fill more than halfway). Return the pureed soup to low heat and bring to a gentle simmer; avoid vigorous boiling to keep the texture silky.

  5. 5

    Stir in the broken fine macaroni and simmer 6–8 minutes, stirring every minute to prevent sticking, until just tender. The noodles will continue softening off-heat, so stop when they are slightly firm. Adjust thickness with a little hot water if needed.

  6. 6

    Lower the heat to the smallest flame. Stir in salt and black pepper. Slowly pour in the room-temperature heavy cream while stirring continuously, then warm 2–3 minutes without boiling. Turn off the heat, fold in the chopped chives, and rest 5 minutes so the flavors round out before serving.

🪪 Recipe Passport

Origin: Persian Cuisine
Researched by: Zaffaron Kitchen
Published: March 16, 2026

Cultural Background

Creamy soups made with peas and small pasta are commonly served as a warming first course in Iranian home cooking, especially in cooler months. Versions with meat and cream are often prepared for guests because the smooth texture and rich finish feel more formal than everyday brothy soups.

Regional Variations

Tehran-style home cooking: Often kept very smooth and pale green, with fine macaroni and a modest amount of cream, served as a light starter before rice dishes.
Northern Iran-inspired: Frequently finished with more fresh herbs (such as extra chives) and a slightly looser consistency, emphasizing a brighter, garden-forward pea flavor.

Researched from multiple sources and validated by the Zaffaron editorial team. Every recipe is tested for accuracy, measurements, and cultural authenticity.

Share:

Nutrition per serving

420
Calories
23g
Protein
22g
Fat
33g
Carbs
6g
Fiber
780mg
Sodium

Pairs well with

If you enjoyed this recipe, here are a few related Zaffaron recipes to try next.

Does your family make this differently?

Every family has their own version. Maybe your grandmother adds a secret ingredient, or your aunt has a completely different technique. Preserve your family's version — with their name on it, forever.

You Might Also Like

Reviews

—
Rated 0.0 out of 5 stars
0 reviews

Cooked this recipe?

Tap the stars to rate it — that's all it takes. A few words are welcome but optional.

Please sign in to rate this recipe.
Rated 0.0 out of 5 stars

No ratings yet. Cooked this one? Be the first to rate it — it takes one tap.